PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G17860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 436aa    MW: 46063.9 Da    PI: 8.3317
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G17860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA602.9e-19351385135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  OPUNC04G17860.1 351 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 385
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.018345381IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-18345399IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.52E-14348408No hitNo description
Gene3DG3DSA:3.30.50.102.0E-15349383IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.35E-15350407No hitNo description
PROSITE patternPS003440351376IPR000679Zinc finger, GATA-type
PfamPF003203.1E-17351385IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MLHQTLIPSS TLSFPSSAPF SPPLLFASNA AATAAQGSNI SRSSSAMPSY AHHHSSLDGK  60
MDALKSSCRS EEAADEGAAA APAAWGMVER DGFSVEDLLD LEEFCEAEKD AAEENEQALV  120
VVAAPEESKS KDDSQPSSVV SYELVAPPPP PPEIVDLPAH DVEELEWVSR IMDDSLSELP  180
PPPQPPASVV ASLAARPPQP RPLQRRPQDG AYRALPPASY PVRTPTICAL STEALVPVKA  240
KRSKRSRATA WSLSGAPPFS DSTSSSSTTT TSSCSSSASF SSFSPLLKFE WHPLGGTSDL  300
PEDHLLPPGK KSKHGKNGKN KPKKRGRKPK QLPPHPSGAA AAAPAPGDRR CSHCGVQKTP  360
QWRAGPEGAK TLCNACGVRY KSGRLLPEYR PACSPTFVSA IHSNSHRKVL EMRRKKEVGS  420
GLLTAAAAAA PAVASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0605740.0AK060574.1 Oryza sativa Japonica Group cDNA clone:001-023-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636682.10.0PREDICTED: GATA transcription factor 6
TrEMBLA0A0E0KTB90.0A0A0E0KTB9_ORYPU; Uncharacterized protein
STRINGBGIOSGA016846-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-39GATA transcription factor 5